Structure of PDB 4v9k Chain BZ Binding Site BS02

Receptor Information

>4v9k Chain BZ (length=185) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQAS
IHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPL
RFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHA
SDLKLPPGVELAVSPEETIAAVVPPEDVEKLAEEA

Ligand information

>4v9k Chain BB (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg

.<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4v9k Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	R10 P15 R19 Y29 R31 R72 Q73 H85 D87 F89
Binding residue (residue number reindexed from 1)	R8 P13 R17 Y27 R29 R70 Q71 H83 D85 F87

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v9k, PDBe:4v9k, PDBj:4v9k
PDBsum	4v9k
PubMed	23812722
UniProt	Q72IA7\|RL25_THET2 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]