Structure of PDB 4v7k Chain BZ Binding Site BS02

Receptor Information

>4v7k Chain BZ (length=184) Species: 300852 (Thermus thermophilus HB8)

YRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQAS
IHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPL
RFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHA
SDLKLPPGVELAVSPEETIAAVVPPEDVEKLAEE

Ligand information

>4v7k Chain BB (length=119)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v7k The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): R10 P15 R19 V27 Y29 N30 R31 N34 R72 Q73 H85 D87
• Binding residue (residue number reindexed from 1): R8 P13 R17 V25 Y27 N28 R29 N32 R70 Q71 H83 D85

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7k, PDBe:4v7k, PDBj:4v7k
• PDBsum: 4v7k
• PubMed: 20005802
• UniProt: Q5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)