Structure of PDB 8ove Chain BY Binding Site BS02

Receptor Information
>8ove Chain BY (length=62) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNPR
FIAWTRTYRRIH
Ligand information
>8ove Chain BH (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugucccucuccaaacgagaguacaugcaugggcuggcaugagcggcacgc
uccauggggcucgaggggcaccgucccgaggcgcugaaccuugaugcuug
gaaucaugcucagggacu
.<<<<<.<<<.......>>>.....<<<<<<<<.<<.....<<<....<.
<<<...>>>.>....<<<......>>>....>>>....>>.....>>>..
....>>>>>...>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
R37 A54 W55 R60
Binding residue
(residue number reindexed from 1)
R36 A53 W54 R59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtO77067

[Back to BioLiP]