Structure of PDB 8ova Chain BY Binding Site BS02

Receptor Information
>8ova Chain BY (length=64) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNP
RFIAWTRTYRRIHR
Ligand information
>8ova Chain BH (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugucccucuccaaacgagaguacaugcaugggcuggcaugagcggcacgc
ucggggcucgaggggcaccgucccgaggcgcugaaccuugaugcuuggaa
uuucaugcucagggacuuu
.<<<<<.<<<.......>>>.....<<<<<<<<.<<.....<<<....<.
<....>.>....<<<......>>>....>>>....>>.....>>>.....
...>>>>>...>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.47 Å
Binding residue
(original residue number in PDB)		R37 K39 A54 W55 R60
Binding residue
(residue number reindexed from 1)		R37 K39 A54 W55 R60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum8ova
PubMed37985661
UniProtQ38B56

[Back to BioLiP]