Structure of PDB 6hiv Chain BY Binding Site BS02

Receptor Information
>6hiv Chain BY (length=102) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAHKESELHQNRLRWVETMKWWEEIGEPHHQQHAASEWEWFRQRVLPAKA
AAMGLSEEDAARELRRAVMHETPRWYSRIQPPNARSEIKEPRDQRWPSSP
KW
Ligand information
>6hiv Chain UC (length=12) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPPPPPPPPPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hiv Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
Resolution7.8 Å
Binding residue
(original residue number in PDB)		L79G N81 R84 W85 Q150
Binding residue
(residue number reindexed from 1)		L8 N11 R14 W15 Q80
Enzymatic activity
Enzyme Commision number ?
External links