Structure of PDB 4v8m Chain BY Binding Site BS02

Receptor Information
>4v8m Chain BY (length=100) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNP
RFIAWTRTYRRIHRKTTTDRVGRRRAARTVRAERAIVGAELSYIQEVRAK
Ligand information
>4v8m Chain BH (length=135) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuugucccucuccaaacgagaguacaugcaugggcuggcaugagcggca
cgcuccacgaccguggggcucgaggggcacuuuacgucccgaggcgcuga
accuugaugcuuggaauuucaugcucagggacuuu
...........................<<..<..<...<......<<...
.<<<<<<<....>>>>>>>......<<<.<.............>.>>>..
....>>.....>......>...>..>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v8m High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
Resolution5.57 Å
Binding residue
(original residue number in PDB)		K39 A54 W55 Y59 R60 H63 R64 K65 D69 R73
Binding residue
(residue number reindexed from 1)		K39 A54 W55 Y59 R60 H63 R64 K65 D69 R73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8m, PDBe:4v8m, PDBj:4v8m
PDBsum4v8m
PubMed23395961
UniProtQ38B56

[Back to BioLiP]