Structure of PDB 4v6u Chain BY Binding Site BS02

Receptor Information
>4v6u Chain BY (length=155) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKLAVIRIRGRVNVKRPVRDTLAMLRLHRVNHCVIVDDTPSYLGMLQKA
KDYITWGEINAETLAKLIRKRGRLIGNKPVTDEYVKEKLGMTIEEFAQKV
VNGEMSLKDLPNLKPVFRLHPPRGGFRGSKKRSFKEGGALGYRGEKINEL
IERML
Ligand information
>4v6u Chain B3 (length=126) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cggcggccauagcgggggggccacacccggucucauuucgaacccggaag
uuaagccccccagcgaucccgguuguacugcccuccgagagggggcggga
agccggggacgccgccggccacuauc
.<<<<<<....<<<<<<<<.....<<<<<<.............>>>>..>
>....>>>>>>.>>..<<<<<<<....<<<<<<.<<....>>>>>>>>..
.>>>>>>>..>>>>>>..........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
Resolution6.6 Å
Binding residue
(original residue number in PDB)		R10 K16 K51 D52 K131 R132 S133 F134 K135 E136
Binding residue
(residue number reindexed from 1)		R10 K16 K51 D52 K131 R132 S133 F134 K135 E136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtQ9HH78|RL30_PYRFU Large ribosomal subunit protein uL30 (Gene Name=rpl30)

[Back to BioLiP]