Structure of PDB 4v7e Chain BX Binding Site BS02

Receptor Information
>4v7e Chain BX (length=142) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGKTRGMGAGRKLKTHRRNQRWADKAYKKSHLGNEWKKPFAGSSHAKGIV
LEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVL
IAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
Resolution5.5 Å
Binding residue
(original residue number in PDB)
Q60 P61
Binding residue
(residue number reindexed from 1)
Q60 P61
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Feb 16 23:28:18 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4v7e', asym_id = 'BX', bs = 'BS02', title = 'Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4v7e', asym_id='BX', bs='BS02', title='Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0015935', uniprot = '', pdbid = '4v7e', asym_id = 'BX'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015935', uniprot='', pdbid='4v7e', asym_id='BX')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>