Structure of PDB 8oin Chain BW Binding Site BS02

Receptor Information
>8oin Chain BW (length=143) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQ
HHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCL
EAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE
Ligand information
>8oin Chain B9 (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaauguagcuuaaauuaucaaagcaaggcacugaaaaugccuagauga
gccucacagcuccauaaacacca
<<<.<<<..<<<...........>>>.<<<<<.......>>>>>....<<
<<......>>>>>>>.>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oin Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		R85 T86 Q87 H88 H89 W110 K113 N121 V122 S157
Binding residue
(residue number reindexed from 1)		R48 T49 Q50 H51 H52 W73 K76 N84 V85 S120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oin, PDBe:8oin, PDBj:8oin
PDBsum8oin
PubMed37141370
UniProtA0A4X1VX01

[Back to BioLiP]