Structure of PDB 6tb3 Chain BW Binding Site BS02

Receptor Information
>6tb3 Chain BW (length=112) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQRKLQQDIDKLLKKVKEGIEDFDDIYEKFQSTDPSNSSHREKLESDLKR
EIKKLQKHRDQIKTWLSKEDVKDKQSVLMTNRRLIENGMERFKSVEKLMK
TKQFSKEALTNP
Ligand information
>6tb3 Chain n (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcgccguggcgcaguggaagcgcgcagggcucauaacccugauguccuc
ggaucgaaaccgagcggcgcuacca
<<<<<<<..<<<<.......>>>>.<<<<<.......>>>>>.....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tb3 The Ccr4-Not complex monitors the translating ribosome for codon optimality.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Q57 R60 K69 E87 E91 K101 K103 F105 S106 K107
Binding residue
(residue number reindexed from 1)		Q56 R59 K68 E86 E90 K100 K102 F104 S105 K106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0030015 CCR4-NOT core complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tb3, PDBe:6tb3, PDBj:6tb3
PDBsum6tb3
PubMed32299921
UniProtQ12514|NOT5_YEAST General negative regulator of transcription subunit 5 (Gene Name=NOT5)

[Back to BioLiP]