Structure of PDB 4v9b Chain BV Binding Site BS02

Receptor Information
>4v9b Chain BV (length=175) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQ
ASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYV
PLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSL
HASDLKLPPGVELAVSPEETIAAVV
Ligand information
>4v9b Chain BB (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcggggga
..<<<<<<<<<<<....<<<<<<<<....<<<<<<...............
>>>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>
.......>>>.>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v9b Structural basis for potent inhibitory activity of the antibiotic tigecycline during protein synthesis.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
R10 R19 V27 Y29 N30 R31 R72 Q73 H85 F89
Binding residue
(residue number reindexed from 1)
R10 R19 V27 Y29 N30 R31 R72 Q73 H85 F89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v9b, PDBe:4v9b, PDBj:4v9b
PDBsum4v9b
PubMed23431179
UniProtQ5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]