Structure of PDB 4v83 Chain BV Binding Site BS02

Receptor Information

>4v83 Chain BV (length=188) Species: 262724 (Thermus thermophilus HB27)

YRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQAS
IHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPL
RFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHA
SDLKLPPGVELAVSPEETIAAVVPPEDVEKLAEEAAAE

Ligand information

>4v83 Chain BB (length=119)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>..
.>...>>>.>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): R10 P15 R19 R20 Y29 N30 N34 R72 Q73 N75 R79 H85 F89
• Binding residue (residue number reindexed from 1): R8 P13 R17 R18 Y27 N28 N32 R70 Q71 N73 R77 H83 F87

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v83, PDBe:4v83, PDBj:4v83
• PDBsum: 4v83
• PubMed: 21245352
• UniProt: Q72IA7|RL25_THET2 Large ribosomal subunit protein bL25 (Gene Name=rplY)