Structure of PDB 4v6i Chain BV Binding Site BS02

Receptor Information
>4v6i Chain BV (length=170) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQ
VLDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAA
NAEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVV
TEKEEAVAKAAEKKVVRLTS
Ligand information
>4v6i Chain DB (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagcg
aaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucuu
ugaacgcacauugcgccccuugguauuccagggggcaugccuguuugagc
gucauuu
........................................<<<<<<....
....>>>..............<......>...................>>
>....<<<...>>><<<<<<<<<....>>>>>>>>>..............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
Resolution8.8 Å
Binding residue
(original residue number in PDB)		Y4 G5 R61 R62 A122
Binding residue
(residue number reindexed from 1)		Y4 G5 R61 R62 A122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
PDBsum4v6i
PubMed20980660
UniProtP05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)

[Back to BioLiP]