Structure of PDB 8c3a Chain BT Binding Site BS02

Receptor Information

>8c3a Chain BT (length=126) Species: 5476 (Candida albicans)

AKISQDVSSSRSKARKAYFTASSVERRVLLSAPLSKELRQQYNVKSLPIR
QNDEVLVVRGSKKGSEGKVNSVYRLKFAIQVDKLQKEKSNGASVPINIHP
SKVVITKLHLDKDRKALIQRKGGKAE

Ligand information

>8c3a Chain AU (length=158)

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauaugaauugcagauauucgugaaucaucgaaucu
uugaacgcacauugcgcccucugguauuccggagggcaugccuguuugag
cgucguuu

.........................................<<<<<<.((
.....>>>.....<.<<<<.....))............>>.>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8c3a New crystal system to promote screening for new eukaryotic inhibitors
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): R12 S13 R16 K17 F20 S23 V25 R28 R51 Q52 V73 Y74 R75 L111 D112 K113 D114 K116 R121
• Binding residue (residue number reindexed from 1): R11 S12 R15 K16 F19 S22 V24 R27 R50 Q51 V72 Y73 R74 L110 D111 K112 D113 K115 R120

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit

External links

• PDB: RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
• PDBsum: 8c3a
• UniProt: A0A8H6F3X2