Structure of PDB 7lh5 Chain BS Binding Site BS02

Receptor Information
>7lh5 Chain BS (length=102) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLAL
KLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAR
EG
Ligand information
>7lh5 Chain BB (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga
<<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lh5 Structural basis for plazomicin antibiotic action and resistance.
Resolution3.27 Å
Binding residue
(original residue number in PDB)		R17 R25 F29 S31 L32 K33 Y36 Q38 G45 V46 T47 L54 G60 N61 K62 T63 K93 H95
Binding residue
(residue number reindexed from 1)		R11 R19 F23 S25 L26 K27 Y30 Q32 G39 V40 T41 L48 G54 N55 K56 T57 K87 H89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lh5, PDBe:7lh5, PDBj:7lh5
PDBsum7lh5
PubMed34117352
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]