Structure of PDB 4w29 Chain BS Binding Site BS02

Receptor Information
>4w29 Chain BS (length=99) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGG
Ligand information
>4w29 Chain BB (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg
...<<<<<<<<....<<.<<<<<....<<<<<<...............>>
>..>>>...>>>>>..>><<<.....<.<<<<<<<<....>>>>>>>>..
.>...>>>.>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		R17 R25 S27 V28 S31 L32 H34 Y36 Q38 G45 V46 T47 S50 N61 K62 T63 R89 Y92 K93 H95 R97
Binding residue
(residue number reindexed from 1)		R7 R15 S17 V18 S21 L22 H24 Y26 Q28 G35 V36 T37 S40 N51 K52 T53 R79 Y82 K83 H85 R87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w29, PDBe:4w29, PDBj:4w29
PDBsum4w29
PubMed25190797
UniProtQ72I20|RL18_THET2 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]