Structure of PDB 4v6a Chain BS Binding Site BS02

Receptor Information
>4v6a Chain BS (length=100) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKL
KGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG
Ligand information
>4v6a Chain BB (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg
.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6a Formation of the first peptide bond: the structure of EF-P bound to the 70S ribosome.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
R17 R25 F29 S31 L32 K33 Y36 Q38 V46 T47 S50 A55 N61 K62 T63 K93 H95 R97
Binding residue
(residue number reindexed from 1)
R9 R17 F21 S23 L24 K25 Y28 Q30 V38 T39 S42 A47 N53 K54 T55 K85 H87 R89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v6a, PDBe:4v6a, PDBj:4v6a
PDBsum4v6a
PubMed19696344
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]