Structure of PDB 4v6a Chain BS Binding Site BS02

Receptor Information

>4v6a Chain BS (length=100) Species: 300852 (Thermus thermophilus HB8)

RRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKL
KGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG

Ligand information

>4v6a Chain BB (length=119)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v6a Formation of the first peptide bond: the structure of EF-P bound to the 70S ribosome.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): R17 R25 F29 S31 L32 K33 Y36 Q38 V46 T47 S50 A55 N61 K62 T63 K93 H95 R97
• Binding residue (residue number reindexed from 1): R9 R17 F21 S23 L24 K25 Y28 Q30 V38 T39 S42 A47 N53 K54 T55 K85 H87 R89

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6a, PDBe:4v6a, PDBj:4v6a
• PDBsum: 4v6a
• PubMed: 19696344
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)