Structure of PDB 4v5m Chain BS Binding Site BS02

Receptor Information

>4v5m Chain BS (length=98) Species: 300852 (Thermus thermophilus HB8)

KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG

Ligand information

>4v5m Chain BB (length=119)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v5m Head Swivel on the Ribosome Facilitates Translocation by Means of Intra-Subunit tRNA Hybrid Sites.
• Resolution: 7.8 Å
• Binding residue (original residue number in PDB): R17 R25 F29 S31 L32 K33 H34 Y36 Q38 I40 D42 V46 T47 S50 K62 T63 Y92 K93 H95 G96 R97
• Binding residue (residue number reindexed from 1): R7 R15 F19 S21 L22 K23 H24 Y26 Q28 I30 D32 V36 T37 S40 K52 T53 Y82 K83 H85 G86 R87

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5m, PDBe:4v5m, PDBj:4v5m
• PDBsum: 4v5m
• PubMed: 21124459
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)