Structure of PDB 4v6u Chain BR Binding Site BS02

Receptor Information
>4v6u Chain BR (length=95) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKAHSFRRKTRKKLSKHPRRRGLPPLTRFLQEFEVGQRVHIVIEPSYHKG
MPDPRFHGRTGTVVGKRGEAYIVEIKDGSKVKTLFIHPVHLRPQK
Ligand information
>4v6u Chain B3 (length=126) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cggcggccauagcgggggggccacacccggucucauuucgaacccggaag
uuaagccccccagcgaucccgguuguacugcccuccgagagggggcggga
agccggggacgccgccggccacuauc
.<<<<<<....<<<<<<<<.....<<<<<<.............>>>>..>
>....>>>>>>.>>..<<<<<<<....<<<<<<.<<....>>>>>>>>..
.>>>>>>>..>>>>>>..........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
Resolution6.6 Å
Binding residue
(original residue number in PDB)		R21 T29
Binding residue
(residue number reindexed from 1)		R19 T27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtQ8U217|RL21_PYRFU Large ribosomal subunit protein eL21 (Gene Name=rpl21e)

[Back to BioLiP]