Structure of PDB 3j9w Chain BR Binding Site BS02

Receptor Information

>3j9w Chain BR (length=120) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNG
VTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGY
LYHGRVKALADAAREAGLKF

Ligand information

>3j9w Chain BB (length=112)

ugguggcgauagcgaagaggucacacccguucccauaccgaacacggaag
uuaagcucuucagcgccgaugguagucggggguuucccccugugagagua
ggacgccgccaa

<<<<<<<....<<<<<<<<.....<<<<<...............>>>..>
>....>>>>>>.>>.<<.......<<.<<<<<...>>>>>.>>.......
>>..>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3j9w Structure of the Bacillus subtilis 70S ribosome reveals the basis for species-specific stalling.
• Resolution: 3.9 Å
• Binding residue (original residue number in PDB): K4 S6 K7 R11 R19 F34 R35 S36 N37 K38 H39 Y41 Q43 T52 S55 T71 Y100 L101 H103 G104 R105
• Binding residue (residue number reindexed from 1): K4 S6 K7 R11 R19 F34 R35 S36 N37 K38 H39 Y41 Q43 T52 S55 T71 Y100 L101 H103 G104 R105

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006364 rRNA processing
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j9w, PDBe:3j9w, PDBj:3j9w
• PDBsum: 3j9w
• PubMed: 25903689
• UniProt: P46899|RL18_BACSU Large ribosomal subunit protein uL18 (Gene Name=rplR)