Structure of PDB 4v8c Chain BQ Binding Site BS02

Receptor Information

>4v8c Chain BQ (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

Ligand information

>4v8c Chain BB (length=122)

aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcggggga

..<<<<<<<<<<<....<<<<<<<<....<<<<<<...............
>>>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>
...>...>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v8c A new understanding of the decoding principle on the ribosome.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): R15 R25 F29 R30 S31 L32 Y36 Q38 G45 V46 T47 S50 L54 K59 K62 T63 Y92 K93 H95 G96 R97
• Binding residue (residue number reindexed from 1): R14 R24 F28 R29 S30 L31 Y35 Q37 G44 V45 T46 S49 L53 K58 K61 T62 Y91 K92 H94 G95 R96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8c, PDBe:4v8c, PDBj:4v8c
• PDBsum: 4v8c
• PubMed: 22437501
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)