Structure of PDB 6qx9 Chain BP Binding Site BS02

Receptor Information
>6qx9 Chain BP (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNY
GSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYE
Ligand information
>6qx9 Chain 2 (length=94) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcuucucggcuguaguaucuguucuuaucaguuuaauaucugauagauu
uuuggagcaucgaccugguauugcaguaccuccaggaacggugc
...........................<<<<<.<....>.>>>>>.....
......<<<<<<.<<<<<.............>>>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qx9 Mechanism of 5' splice site transfer for human spliceosome activation.
Resolution3.28 Å
Binding residue
(original residue number in PDB)
D97 E101
Binding residue
(residue number reindexed from 1)
D96 E100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045893 positive regulation of DNA-templated transcription
GO:0048863 stem cell differentiation
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0016363 nuclear matrix
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6qx9, PDBe:6qx9, PDBj:6qx9
PDBsum6qx9
PubMed30975767
UniProtQ7RTV0|PHF5A_HUMAN PHD finger-like domain-containing protein 5A (Gene Name=PHF5A)

[Back to BioLiP]