Structure of PDB 4v61 Chain BP Binding Site BS02

Receptor Information
>4v61 Chain BP (length=116) Species: 3562 (Spinacia oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRHGRKVPKLNRPPDQRRALLRGLTTQLLKHGRIKTTKARARAVRKYVDK
MITMAKDGSLHKRRQALGFIYEKQIVHALFAEVPDRYGERNGGYTRIIRT
LPRRGDNAPMAYIELV
Ligand information
>4v61 Chain BC (length=103) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaggucacggcgagacgagccguuuaucauuacgauaggugucaagugg
aagugcagugauguaugcagcugaggcauccuaacagacccacagacuug
aac
...<<<.<<<<<.......>>>>>.............<.<<<<<.<<<..
...<<<<....>>>>....>>>..>>>>>..>.....>>>..........
...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v61 Cryo-EM study of the spinach chloroplast ribosome reveals the structural and functional roles of plastid-specific ribosomal proteins
Resolution9.4 Å
Binding residue
(original residue number in PDB)		M90 H92 G93 K95 R131 K135 D138 K139 T142 H150 K151 R153 Q154 R179 N180 G181 G182 R185 R188
Binding residue
(residue number reindexed from 1)		M1 H3 G4 K6 R42 K46 D49 K50 T53 H61 K62 R64 Q65 R90 N91 G92 G93 R96 R99
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 17:38:35 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4v61', asym_id = 'BP', bs = 'BS02', title = 'Cryo-EM study of the spinach chloroplast ribosom...nal roles of plastid-specific ribosomal proteins '
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4v61', asym_id='BP', bs='BS02', title='Cryo-EM study of the spinach chloroplast ribosom...nal roles of plastid-specific ribosomal proteins ')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v61', asym_id = 'BP'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v61', asym_id='BP')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>