Structure of PDB 8eub Chain BO Binding Site BS02

Receptor Information
>8eub Chain BO (length=127) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGL
RIGRIEDVTPVPSDSTRKKGGRRGRRL
Ligand information
>8eub Chain EC (length=195) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuccauguauugguuacccaucugcaucgaaaacucuccgaacacua
ggugcaguaaggcuuucauggagugguuugcuauuuagcguacguguacc
auaggcagccccaaaaacacgugugaggagaaagucccagucacuuuggg
caaaguagacagccgcgcuugcguggugggacuuaauuaaugccu
...<<<<<<...............<<<<<........(((((........
..>>>>>..........>>>>>><<<...<<......>>.........>>
>..<<.....>>..............)))))..<<..<.<<<<<<<.(((
(.>>>>.>>>..<<<<<....>>>>>..>.>>.........))))
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eub Regulation of translation by ribosomal RNA pseudouridylation.
Resolution2.52 Å
Binding residue
(original residue number in PDB)		Y58 R107
Binding residue
(residue number reindexed from 1)		Y48 R97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eub, PDBe:8eub, PDBj:8eub
PDBsum8eub
PubMed37595043
UniProtP06367|RS14A_YEAST Small ribosomal subunit protein uS11A (Gene Name=RPS14A)

[Back to BioLiP]