Structure of PDB 4xej Chain BL05 Binding Site BS02

Receptor Information

>4xej Chain BL05 (length=181) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PLDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

Ligand information

>4xej Chain B5S (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg

.<<<<<<<<<.....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>..
.>...>>>..>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
Resolution	3.8 Å
Binding residue (original residue number in PDB)	N27 W29 Q66 K67 P68 A69 R91 T93 R95 R96 R98
Binding residue (residue number reindexed from 1)	N26 W28 Q65 K66 P67 A68 R90 T92 R94 R95 R97

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4xej, PDBe:4xej, PDBj:4xej
PDBsum	4xej
PubMed	25652826
UniProt	Q72I16\|RL5_THET2 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]