Structure of PDB 4v8m Chain BL Binding Site BS02

Receptor Information

>4v8m Chain BL (length=169) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ANPMREIVVKKLCINICVGESGDRLTRASKVLEQLCEQTPVLSRARLTVR
TFGIRRNEKIAVHCTVRGKKAEELLEKGLKVKEFELKSYNFSDTGSFGFG
ISEHIDLGIKYDPSTGIYGMDFYVVLGRRGERVAHRKRRVSRVGFNHRVR
KEEAMKWFEKVHDGIIFQA

Ligand information

>4v8m Chain BD (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggguacgaccauacuuggccgaaugcaccauaucccguccgauuugugaa
guuaagcggccacaggccucguuaguacggcgaucagugauggcgcugga
acccgggguguuguacucu

<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<......<<<<<.<<<....>>>>>>>>..
...>>>>>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4v8m High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
Resolution	5.57 Å
Binding residue (original residue number in PDB)	P15 M16 R17 Q50 T51 T77 R79 R141 G142 R144 V145 H147 R148 R151 R154 G156 F157 N158 H159
Binding residue (residue number reindexed from 1)	P3 M4 R5 Q38 T39 T65 R67 R129 G130 R132 V133 H135 R136 R139 R142 G144 F145 N146 H147

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006364	rRNA processing
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8m, PDBe:4v8m, PDBj:4v8m
PDBsum	4v8m
PubMed	23395961
UniProt	Q38EI9

[Back to BioLiP]