Structure of PDB 6i7o Chain BI Binding Site BS02

Receptor Information
>6i7o Chain BI (length=294) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVV
RFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGL
LIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRT
TTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGH
VSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAF
KPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>6i7o Chain BR (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i7o Collided ribosomes form a unique structural interface to induce Hel2-driven quality control pathways.
Resolution5.3 Å
Binding residue
(original residue number in PDB)		K8 S13 S14 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 I69 T70 G71 D72 V74 Y79 H90 G91 N94 Q151 R152 T155 G156 A157 R158 Y198 H203 Y207 E210 R218 E221 L222 K224 F253 P255 T256 K258 K259 F260 K262 Q264 Y265 A266 E268 S269 K270 Y272 R273 Q274 K276 L277 K279 R282 R285 K289
Binding residue
(residue number reindexed from 1)		K5 S10 S11 T15 F17 R18 R19 R21 K24 T25 Y27 R30 R47 R51 T53 N54 I66 T67 G68 D69 V71 Y76 H87 G88 N91 Q148 R149 T152 G153 A154 R155 Y195 H200 Y204 E207 R215 E218 L219 K221 F250 P252 T253 K255 K256 F257 K259 Q261 Y262 A263 E265 S266 K267 Y269 R270 Q271 K273 L274 K276 R279 R282 K286
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6i7o, PDBe:6i7o, PDBj:6i7o
PDBsum6i7o
PubMed30609991
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]