Structure of PDB 5mc6 Chain BI Binding Site BS02

Receptor Information
>5mc6 Chain BI (length=296) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>5mc6 Chain BR (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mc6 The cryo-EM structure of a ribosome-Ski2-Ski3-Ski8 helicase complex.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		K8 S10 S13 S14 F16 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 K58 D59 Q63 I65 I69 T70 D72 V73 V74 G91 N94 W95 Q151 R152 T155 A157 R158 Y198 H203 Y207 E210 R218 E221 K224 F253 K258 F260 K262 Y265 E268 S269 K270 Y272 K276 K279 R285 K289
Binding residue
(residue number reindexed from 1)		K7 S9 S12 S13 F15 T17 F19 R20 R21 R23 K26 T27 Y29 R32 R49 R53 T55 N56 K57 D58 Q62 I64 I68 T69 D71 V72 V73 G90 N93 W94 Q150 R151 T154 A156 R157 Y197 H202 Y206 E209 R217 E220 K223 F252 K257 F259 K261 Y264 E267 S268 K269 Y271 K275 K278 R284 K288
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mc6, PDBe:5mc6, PDBj:5mc6
PDBsum5mc6
PubMed27980209
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]