Structure of PDB 4v4t Chain BG Binding Site BS02

Receptor Information

>4v4t Chain BG (length=122) Species: 274 (Thermus thermophilus)

FHEMREPRIEKVVVHMGIGHANAEDILGEITGQMPVRTKAKRTVGEFDIR
EGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGLDVTVNL
VRPGYRVAKRDKASRSIPTKHR

Ligand information

>4v4t Chain BB (length=123)

aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcgggggau

..<<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>
>>>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>
.......>>>.>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v4t Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
• Resolution: 6.46 Å
• Binding residue (original residue number in PDB): E12 M13 R17 G46 Q47 M48 V50 T74 R76 R140 V141 R144 A147 S148 R149
• Binding residue (residue number reindexed from 1): E3 M4 R8 G32 Q33 M34 V36 T60 R62 R106 V107 R110 A113 S114 R115

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4t, PDBe:4v4t, PDBj:4v4t
• PDBsum: 4v4t
• PubMed: 16377566
• UniProt: P14124|RL5_HALMA Large ribosomal subunit protein uL5 (Gene Name=rpl5)