Structure of PDB 4v4s Chain BG Binding Site BS02

Receptor Information
>4v4s Chain BG (length=122) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FHEMREPRIEKVVVHMGIGHANAEDILGEITGQMPVRTKAKRTVGEFDIR
EGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGLDVTVNL
VRPGYRVAKRDKASRSIPTKHR
Ligand information
>4v4s Chain BB (length=123) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcgggggau
..<<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>
>>>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>
.......>>>.>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v4s Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
Resolution6.76 Å
Binding residue
(original residue number in PDB)
E12 M13 R17 G46 Q47 M48 V50 T74 R76 R140 V141 R144 A147 S148 R149
Binding residue
(residue number reindexed from 1)
E3 M4 R8 G32 Q33 M34 V36 T60 R62 R106 V107 R110 A113 S114 R115
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v4s, PDBe:4v4s, PDBj:4v4s
PDBsum4v4s
PubMed16377566
UniProtP14124|RL5_HALMA Large ribosomal subunit protein uL5 (Gene Name=rpl5)

[Back to BioLiP]