Structure of PDB 7o7y Chain BF Binding Site BS02

Receptor Information
>7o7y Chain BF (length=226) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMA
RMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTF
VKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDN
TLIARSLGKYNIICMEDLIHEIYTVGKHFKEANNFLWPFKLSSPRGGMKK
KTTHFVEGGDAGNREDQINRLIRRMN
Ligand information
>7o7y Chain B7 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcuu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o7y Structural basis of ribosomal frameshifting during translation of the SARS-CoV-2 RNA genome.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R133 E136 P137 K221 T223 T224 H225 V227 E228
Binding residue
(residue number reindexed from 1)		R112 E115 P116 K200 T202 T203 H204 V206 E207
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Nov 26 06:29:17 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7o7y', asym_id = 'BF', bs = 'BS02', title = 'Structural basis of ribosomal frameshifting during translation of the SARS-CoV-2 RNA genome.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7o7y', asym_id='BF', bs='BS02', title='Structural basis of ribosomal frameshifting during translation of the SARS-CoV-2 RNA genome.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0000463,0003723,0003735', uniprot = '', pdbid = '7o7y', asym_id = 'BF'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000463,0003723,0003735', uniprot='', pdbid='7o7y', asym_id='BF')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>