Structure of PDB 6skf Chain BF Binding Site BS02

Receptor Information

>6skf Chain BF (length=169) Species: 311400 (Thermococcus kodakarensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NREAILADWEAHPMRKPRIAKVTINIGVGESGERLTKAETMLEQLVGQKP
IRRRAKQTNRDFGIRRGEPIAVKVTLRGEKAYQMLDRLLEAVDRKLKASN
FDEHGNFCFGIQEHINIPGIFGMDVCVTLERPGFRVAKRKRQRRKIPTKH
KLTKEEGIVFAMEELKAKV

Ligand information

>6skf Chain BB (length=125) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gguacggcggccauagcggcggggccacacccggucucguuucgaccccg
gaaguuaagcccgccagcguucccggguguacugcccuccgagagggggc
gggaaaccgggaacgccgccggcca

<<<.<<<<<<<....<<<<<<<<.....<<<<<<....<<....>>.>>>
>..>>....>>>>>>.>>.<<<<<<<......<<<<<.<<....>>>>>>
>.....>>>>>>>.>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6skf Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
Resolution	2.95 Å
Binding residue (original residue number in PDB)	H15 M17 K52 I54 P143 G144 R146 R150 R155 K160
Binding residue (residue number reindexed from 1)	H12 M14 K49 I51 P132 G133 R135 R139 R144 K149

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6skf, PDBe:6skf, PDBj:6skf
PDBsum	6skf
PubMed	32555463
UniProt	Q5JJG1\|RL5_THEKO Large ribosomal subunit protein uL5 (Gene Name=rpl5)

[Back to BioLiP]