Structure of PDB 8p6j Chain BBB Binding Site BS02

Receptor Information
>8p6j Chain BBB (length=104) Species: 301448 (Streptococcus pyogenes serotype M3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DARSVNGEFPRHVKLKNEIENLLDQVTQLYTKHNSNYQQYNAQAGRLDLR
QKAEYLKGLNDWAERLLQELNGEDVKKVLGKVAFEKDDLEKEVKELKEKI
DKKE
Ligand information
>8p6j Chain DDD (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPPGPPGPPGVPGEAGPPGPPGPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p6j Structural basis for collagen recognition by the Streptococcus pyogenes M3 protein
Resolution2.324 Å
Binding residue
(original residue number in PDB)		Q46 R49 Y58 G61 W65 L69
Binding residue
(residue number reindexed from 1)		Q43 R46 Y55 G58 W62 L66
Enzymatic activity
Enzyme Commision number ?
External links