Structure of PDB 4v68 Chain B3 Binding Site BS02

Receptor Information
>4v68 Chain B3 (length=59) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKV
AHLVRVEVV
Ligand information
>4v68 Chain BB (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg
.<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v68 GTPase activation of elongation factor EF-Tu by the ribosome during decoding
Resolution6.4 Å
Binding residue
(original residue number in PDB)		Q19 H52
Binding residue
(residue number reindexed from 1)		Q19 H52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v68, PDBe:4v68, PDBj:4v68
PDBsum4v68
PubMed19229291
UniProtQ5SHQ6|RL30_THET8 Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]