Structure of PDB 9enp Chain B Binding Site BS02

Receptor Information
>9enp Chain B (length=266) Species: 10306 (Human alphaherpesvirus 1 strain KOS) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAPCQVVLQGAELNGILQAFAPLRTSLLDSLLVMGDRGILIHNTIFGEQV
FLPLEHSQFSRYRWRGPTAAFLSLVDQKRSLLSVFRANQYPDLRRVELAI
TGQAPFRTLVQRIWTTTSDGEAVELASETLMKRELTSFVVLVPQGTPDVQ
LRLTRPQLTKVLNATGADSATPTTFELGVNGKFSVFTTSTCVTFAAREEN
AKTVYGENTHRTFSVVVDDCSMRAVLRRLQVGGGTLKFFLTTPVPSLCVT
ATGPNAVSAVFLLKPQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9enp Dynamics of the Herpes simplex virus DNA polymerase holoenzyme during DNA synthesis and proof-reading revealed by Cryo-EM
Resolution2.12 Å
Binding residue
(original residue number in PDB)		R51 T52 R113 R279 R280
Binding residue
(residue number reindexed from 1)		R24 T25 R86 R227 R228
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0039686 bidirectional double-stranded viral DNA replication
Cellular Component
GO:0042025 host cell nucleus
GO:0042575 DNA polymerase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9enp, PDBe:9enp, PDBj:9enp
PDBsum9enp
PubMed38806233
UniProtP10226|PAP_HHV11 DNA polymerase processivity factor (Gene Name=UL42)

[Back to BioLiP]