Structure of PDB 9c3u Chain B Binding Site BS02

Receptor Information
>9c3u Chain B (length=249) Species: 95486 (Burkholderia cenocepacia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPSGIELHNRDFLTDAAHLPDASIDLIVADPPYGLGKDYGNDSDKRSGDD
FLAWTREWLELAIPKLKPSGSMYIFCTWQYAPEIFSFLKTQLTMVNEIIW
DRRVPSMGGTTRRFTSVHDNIGFFAVSRAYYFDLDPVRIPYDADTKKARS
RKLFEGSKWLEMGYNPKDVWSVSRLHRQHAERVDHPTQKPLEIIERMVLA
SCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYCAIAHERVNAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9c3u Burkholderia cenocepacia epigenetic regulator M.BceJIV simultaneously engages two DNA recognition sequences for methylation.
Resolution2.77 Å
Binding residue
(original residue number in PDB)		R167 Y170 R178 R180 K187 W188 Y193 N194 K196
Binding residue
(residue number reindexed from 1)		R138 Y141 R149 R151 K158 W159 Y164 N165 K167
External links