Structure of PDB 9bdv Chain B Binding Site BS02

Receptor Information

>9bdv Chain B (length=274) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYT
GPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLG
IQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRD
PAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCD
KVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVR
VSMQLRRPSDRELSEPMEFQYLPD

Ligand information

>9bdv Chain D (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcactggaaattcccagt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	9bdv Transient interactions modulate affinity of NF-kappaB transcription factors for DNA
Resolution	1.9 Å
Binding residue (original residue number in PDB)	R33 R35 S42
Binding residue (residue number reindexed from 1)	R16 R18 S25

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:9bdv, PDBe:9bdv, PDBj:9bdv
PDBsum	9bdv
PubMed	38805268
UniProt	Q04207\|TF65_MOUSE Transcription factor p65 (Gene Name=Rela)

[Back to BioLiP]