Structure of PDB 9b0z Chain B Binding Site BS02

Receptor Information
>9b0z Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQM
EVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDA
Ligand information
>9b0z Chain E (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RWACQSCTFENEAAAVLCSICERPRLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9b0z Linkage and substrate specificity conferred by NZF ubiquitin binding domains
Resolution2.41 Å
Binding residue
(original residue number in PDB)		K429 K440
Binding residue
(residue number reindexed from 1)		K11 K22
External links
PDB RCSB:9b0z, PDBe:9b0z, PDBj:9b0z
PDBsum9b0z
PubMed
UniProtQ96CV9|OPTN_HUMAN Optineurin (Gene Name=OPTN)

[Back to BioLiP]