Structure of PDB 8yzs Chain B Binding Site BS02

Receptor Information
>8yzs Chain B (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVL
LRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFA
PNFKESEMNAIAADMCTNARRVVRKSWMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yzs Structural basis of DNA recognition by BEN domain proteins reveals a role for oligomerization in unmethylated DNA selection by BANP.
Resolution2.31 Å
Binding residue
(original residue number in PDB)		C416 G419 I420 R421 S423 N425 R429 T465 R468 R469
Binding residue
(residue number reindexed from 1)		C68 G71 I72 R73 S75 N77 R81 T117 R120 R121
External links
PDB RCSB:8yzs, PDBe:8yzs, PDBj:8yzs
PDBsum8yzs
PubMed39225042
UniProtQ96RE7|NACC1_HUMAN Nucleus accumbens-associated protein 1 (Gene Name=NACC1)

[Back to BioLiP]