Structure of PDB 8wha Chain B Binding Site BS02

Receptor Information
>8wha Chain B (length=85) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVI
RDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFG
Ligand information
>8wha Chain J (length=142) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcggatgtatatatctgacacgtgcctggagactagggagtaatcccctt
gggcggttaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wha Molecular basis of chromatin remodelling by DDM1 involved in plant DNA methylation.
Resolution4.05 Å
Binding residue
(original residue number in PDB)		R35 R45 I46 S47 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R19 R29 I30 S31 G32 R62 K63 T64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0009414 response to water deprivation
Cellular Component
GO:0000325 plant-type vacuole
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005777 peroxisome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009506 plasmodesma
GO:0009507 chloroplast
GO:0009536 plastid
GO:0009579 thylakoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wha, PDBe:8wha, PDBj:8wha
PDBsum8wha
PubMed38413824
UniProtP59259|H4_ARATH Histone H4 (Gene Name=At1g07660)

[Back to BioLiP]