Structure of PDB 8vne Chain B Binding Site BS02

Receptor Information
>8vne Chain B (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vne Homing endonuclease I-PpoI-DNA complex:reaction with 500 uM Mg2+ for 160s
Resolution1.57 Å
Binding residue
(original residue number in PDB)
A248 P249 G253 K256 N257 K265
Binding residue
(residue number reindexed from 1)
A47 P48 G52 K55 N56 K64
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8vne, PDBe:8vne, PDBj:8vne
PDBsum8vne
PubMed
UniProtQ94702|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]