Structure of PDB 8un0 Chain B Binding Site BS02

Receptor Information
>8un0 Chain B (length=319) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGK
TTSILCLARALLGPALKDAMLELNASNDRGIDVVRNKIKMFAQQKVTLPK
GRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQ
SRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQA
LNNLQSTFSGFGFINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKIL
AHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVN
SLLQMAGLLARLCQKTMAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8un0 Cryo-EM reveals a nearly complete PCNA loading process and unique features of the human alternative clamp loader CTF18-RFC.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		D175 K304
Binding residue
(residue number reindexed from 1)		D143 K272
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003689 DNA clamp loader activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0017116 single-stranded DNA helicase activity
GO:0019899 enzyme binding
Biological Process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006281 DNA repair
GO:0032508 DNA duplex unwinding
GO:1900264 positive regulation of DNA-directed DNA polymerase activity
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005663 DNA replication factor C complex
GO:0031390 Ctf18 RFC-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8un0, PDBe:8un0, PDBj:8un0
PDBsum8un0
PubMed38669181
UniProtP35250|RFC2_HUMAN Replication factor C subunit 2 (Gene Name=RFC2)

[Back to BioLiP]