Structure of PDB 8u8l Chain B Binding Site BS02

Receptor Information
>8u8l Chain B (length=123) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRIEKRTKFTVDDHVVAWKFIYEKLVEADKEGVQLMPKGIAFWNDFVRVT
RSSKSATNWSSHFRKIMCPGLHEMPLHKKTILYLLKNIGIEIDKETEQII
ERKFNVKLLVGIDRNLISYKLLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u8l Caenorhabditis elegans telomere-binding proteins TEBP-1 and TEBP-2 adapt the Myb module to dimerize and bind telomeric DNA
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R357 T358 F360 K405 S406 N409 S412 H413
Binding residue
(residue number reindexed from 1)		R6 T7 F9 K54 S55 N58 S61 H62
Enzymatic activity
Enzyme Commision number ?
External links