Structure of PDB 8tdw Chain B Binding Site BS02

Receptor Information
>8tdw Chain B (length=471) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNR
FEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGHGPFS
HMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEED
ICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWD
YFARDCHHLGIQNNFDYKRFIKFARVCEVDNELRICARDKEVGNLYDMFH
TRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAID
DMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTG
QIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYNPIDHVS
FYCKTAPNRAIRITKEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKP
QDGDVIAPLITPQKKEWNDST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tdw Guanine-containing ssDNA and RNA induce dimeric and tetrameric structural forms of SAMHD1.
Resolution3.04 Å
Binding residue
(original residue number in PDB)		V117 I118 N119 H125 D137 R145
Binding residue
(residue number reindexed from 1)		V3 I4 N5 H11 D23 R31
Enzymatic activity
Enzyme Commision number 3.1.5.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003697 single-stranded DNA binding
GO:0003723 RNA binding
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008270 zinc ion binding
GO:0008832 dGTPase activity
GO:0016787 hydrolase activity
GO:0016793 triphosphoric monoester hydrolase activity
GO:0032567 dGTP binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0106375 deoxynucleoside triphosphate hydrolase activity
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006203 dGTP catabolic process
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0006955 immune response
GO:0006974 DNA damage response
GO:0009264 deoxyribonucleotide catabolic process
GO:0016446 somatic hypermutation of immunoglobulin genes
GO:0045087 innate immune response
GO:0045088 regulation of innate immune response
GO:0046061 dATP catabolic process
GO:0051289 protein homotetramerization
GO:0051607 defense response to virus
GO:0060339 negative regulation of type I interferon-mediated signaling pathway
GO:0110025 DNA strand resection involved in replication fork processing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005886 plasma membrane
GO:0035861 site of double-strand break
GO:0097197 tetraspanin-enriched microdomain

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8tdw, PDBe:8tdw, PDBj:8tdw
PDBsum8tdw
PubMed37930833
UniProtQ9Y3Z3|SAMH1_HUMAN Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 (Gene Name=SAMHD1)

[Back to BioLiP]