Structure of PDB 8rpx Chain B Binding Site BS02

Receptor Information
>8rpx Chain B (length=156) Species: 1206749 (Nitrolancea hollandica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LENLTTRELLAVSRASLRELKRRGVIRSGNAPAGDYAELLVQRATDGELA
NASQKSWDIRTTEGDRLQVKARVITDEHANGERQLSTIRSWDFDAAVIVL
FDDNFRVWRAARVPAAIMKEAAYYSQHVRGYTVYAKDALLNHSEVEDWTE
QLRSVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rpx Structural analysis of the BisI family of modification dependent restriction endonucleases
Resolution1.81 Å
Binding residue
(original residue number in PDB)		G46 K67 A83 R84 V85 Q96 S98
Binding residue
(residue number reindexed from 1)		G34 K55 A71 R72 V73 Q84 S86
External links