Structure of PDB 8rkg Chain B Binding Site BS02

Receptor Information
>8rkg Chain B (length=168) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FWDLEVKFTGQTSLLGMSEARQRGYQFSSDPYYLTVQASYSAFGLNVFNL
ENQRLYVADLRLVSGSPRISIDTPMICARDSPSCNSTHATVLIPFFGGVL
TGINVNSVNIQLSSYSLQQHGITLDSRNGYRLYIKRSTLKGDRNDVLVLT
FIYYGKTVPMLISLVCSG
Ligand information
>8rkg Chain M (length=22) Species: 8355 (Xenopus laevis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVVTCTKDSMTVRIPRTLSGFD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rkg The vitelline envelope to fertilization envelope conversion in eggs of Xenopus laevis.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		D195 Y197 Y198 L199 T200 V201 Q202 A203 Y205 M242 I243 C244 P326 M327 L328 I329
Binding residue
(residue number reindexed from 1)		D30 Y32 Y33 L34 T35 V36 Q37 A38 Y40 M75 I76 C77 P159 M160 L161 I162
Enzymatic activity
Enzyme Commision number ?
External links