Structure of PDB 8opt Chain B Binding Site BS02

Receptor Information
>8opt Chain B (length=42) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLK
Ligand information
Ligand IDZN
InChIInChI=1S/Zn/q+2
InChIKeyPTFCDOFLOPIGGS-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Zn++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Zn+2]
FormulaZn
NameZINC ION
ChEMBLCHEMBL1236970
DrugBankDB14532
ZINC
PDB chain8opt Chain B Residue 301 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8opt Structural basis for activity switching in polymerases determining the fate of let-7 pre-miRNAs
Resolution3.65 Å
Binding residue
(original residue number in PDB)		C139 C152
Binding residue
(residue number reindexed from 1)		C4 C17
Annotation score4
Gene Ontology
Molecular Function
GO:0002151 G-quadruplex RNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0031369 translation initiation factor binding
GO:0035198 miRNA binding
GO:0046872 metal ion binding
GO:0070883 pre-miRNA binding
GO:0140517 protein-RNA adaptor activity
GO:1990825 sequence-specific mRNA binding
Biological Process
GO:0007281 germ cell development
GO:0010586 miRNA metabolic process
GO:0010587 miRNA catabolic process
GO:0010629 negative regulation of gene expression
GO:0017148 negative regulation of translation
GO:0019827 stem cell population maintenance
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031054 pre-miRNA processing
GO:0031123 RNA 3'-end processing
GO:0032008 positive regulation of TOR signaling
GO:0045666 positive regulation of neuron differentiation
GO:0045686 negative regulation of glial cell differentiation
GO:0045727 positive regulation of translation
GO:0048863 stem cell differentiation
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0060964 regulation of miRNA-mediated gene silencing
GO:0071076 RNA 3' uridylation
GO:0071333 cellular response to glucose stimulus
GO:1901724 positive regulation of cell proliferation involved in kidney development
GO:2000632 negative regulation of pre-miRNA processing
GO:2000767 positive regulation of cytoplasmic translation
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8opt, PDBe:8opt, PDBj:8opt
PDBsum8opt
PubMed39054354
UniProtQ9H9Z2|LN28A_HUMAN Protein lin-28 homolog A (Gene Name=LIN28A)

[Back to BioLiP]