Structure of PDB 8kfr Chain B Binding Site BS02

Receptor Information
>8kfr Chain B (length=163) Species: 4577 (Zea mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GWVIGVDPDIGGAIAVLSPDGSSQVFDNPFVHIVVSEVIRKRLDTKSIIQ
LLRGLDAPPGTTAYIEKSSPFPTDGKQGWWSTGFSYGLWIASLVASGFSV
VPIASQTWKAYFGLMRSETPKDDSRQAASILFPDKDQSLKLKKHHGRAEA
LLLAAYGKGLVLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kfr MOC1 cleaves Holliday junctions through a cooperative nick and counter-nick mechanism mediated by metal ions.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		V143 S144 R148 D182 G183 K184 Q185 G186 L249 K250 K251
Binding residue
(residue number reindexed from 1)		V35 S36 R40 D74 G75 K76 Q77 G78 L141 K142 K143
External links