Structure of PDB 8kcc Chain B Binding Site BS02

Receptor Information
>8kcc Chain B (length=104) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSKSMKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLE
LAGNAARDNKKSRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINSV
LLPK
Ligand information
>8kcc Chain J (length=150) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaggatgtatatatgtgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctccaggat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kcc Mechanism of heterochromatin remodeling revealed by the DDM1 bound nucleosome structures.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		V24 R41 R86
Binding residue
(residue number reindexed from 1)		V1 R18 R63
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
Biological Process
GO:0070828 heterochromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0000792 heterochromatin
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005721 pericentric heterochromatin
GO:0005730 nucleolus
GO:0009506 plasmodesma
GO:0009536 plastid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8kcc, PDBe:8kcc, PDBj:8kcc
PDBsum8kcc
PubMed38870940
UniProtQ9FJE8|H2A7_ARATH Probable histone H2A.7 (Gene Name=At5g59870)

[Back to BioLiP]