Structure of PDB 8k8a Chain B Binding Site BS02

Receptor Information
>8k8a Chain B (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLS
LKLKFGLIS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k8a Structural basis for specific DNA sequence recognition by the transcription factor NFIL3.
Resolution2.07 Å
Binding residue
(original residue number in PDB)		Y76 R80 N83 N84 R91
Binding residue
(residue number reindexed from 1)		Y5 R9 N12 N13 R20
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8k8a, PDBe:8k8a, PDBj:8k8a
PDBsum8k8a
PubMed38382670
UniProtQ16649|NFIL3_HUMAN Nuclear factor interleukin-3-regulated protein (Gene Name=NFIL3)

[Back to BioLiP]